Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 381493..382067 | Replicon | chromosome |
| Accession | NZ_CP097797 | ||
| Organism | Pasteurella multocida strain 29135 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A849CFF7 |
| Locus tag | M9418_RS01720 | Protein ID | WP_014667974.1 |
| Coordinates | 381783..382067 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A849CG04 |
| Locus tag | M9418_RS01715 | Protein ID | WP_014391174.1 |
| Coordinates | 381493..381786 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9418_RS01695 (M9418_01695) | 376658..377749 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
| M9418_RS01700 (M9418_01700) | 378098..379888 | + | 1791 | WP_014667976.1 | PTS ascorbate-specific subunit IIBC | - |
| M9418_RS01705 (M9418_01705) | 379933..380400 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
| M9418_RS01710 (M9418_01710) | 380418..381095 | + | 678 | WP_014667975.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
| M9418_RS01715 (M9418_01715) | 381493..381786 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
| M9418_RS01720 (M9418_01720) | 381783..382067 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
| M9418_RS01730 (M9418_01730) | 383361..383622 | - | 262 | Protein_334 | hypothetical protein | - |
| M9418_RS01735 (M9418_01735) | 383934..384119 | - | 186 | WP_016534551.1 | hypothetical protein | - |
| M9418_RS01740 (M9418_01740) | 384419..386605 | - | 2187 | WP_014667973.1 | S8 family peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 383361..383522 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T246245 WP_014667974.1 NZ_CP097797:c382067-381783 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CFF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A849CG04 |