Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1707549..1708123 | Replicon | chromosome |
Accession | NZ_CP097796 | ||
Organism | Pasteurella multocida strain 40540 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A849CFF7 |
Locus tag | M9420_RS08085 | Protein ID | WP_014667974.1 |
Coordinates | 1707549..1707833 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A849CG04 |
Locus tag | M9420_RS08090 | Protein ID | WP_014391174.1 |
Coordinates | 1707830..1708123 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9420_RS08065 (M9420_08065) | 1703011..1705197 | + | 2187 | WP_014667973.1 | S8 family peptidase | - |
M9420_RS08070 (M9420_08070) | 1705497..1705682 | + | 186 | WP_016534551.1 | hypothetical protein | - |
M9420_RS08075 (M9420_08075) | 1705994..1706255 | + | 262 | Protein_1556 | hypothetical protein | - |
M9420_RS08085 (M9420_08085) | 1707549..1707833 | + | 285 | WP_014667974.1 | addiction module protein | Toxin |
M9420_RS08090 (M9420_08090) | 1707830..1708123 | + | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
M9420_RS08095 (M9420_08095) | 1708521..1709198 | - | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
M9420_RS08100 (M9420_08100) | 1709216..1709683 | - | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
M9420_RS08105 (M9420_08105) | 1709728..1711518 | - | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
M9420_RS08110 (M9420_08110) | 1711867..1712958 | + | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1706094..1706255 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T246244 WP_014667974.1 NZ_CP097796:1707549-1707833 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CFF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CG04 |