Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1766999..1767573 | Replicon | chromosome |
Accession | NZ_CP097793 | ||
Organism | Pasteurella multocida strain 21275 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A849CFF7 |
Locus tag | M9417_RS08640 | Protein ID | WP_014667974.1 |
Coordinates | 1766999..1767283 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A849CG04 |
Locus tag | M9417_RS08645 | Protein ID | WP_014391174.1 |
Coordinates | 1767280..1767573 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9417_RS08620 (M9417_08620) | 1762462..1764648 | + | 2187 | WP_079157817.1 | S8 family peptidase | - |
M9417_RS08625 (M9417_08625) | 1764948..1765100 | + | 153 | WP_014391177.1 | hypothetical protein | - |
M9417_RS08630 (M9417_08630) | 1765444..1765705 | + | 262 | Protein_1666 | hypothetical protein | - |
M9417_RS08640 (M9417_08640) | 1766999..1767283 | + | 285 | WP_014667974.1 | addiction module protein | Toxin |
M9417_RS08645 (M9417_08645) | 1767280..1767573 | + | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
M9417_RS08650 (M9417_08650) | 1767970..1768647 | - | 678 | WP_014391173.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
M9417_RS08655 (M9417_08655) | 1768665..1769132 | - | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
M9417_RS08660 (M9417_08660) | 1769177..1770967 | - | 1791 | WP_014391171.1 | PTS ascorbate-specific subunit IIBC | - |
M9417_RS08665 (M9417_08665) | 1771316..1772407 | + | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1765544..1765705 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T246241 WP_014667974.1 NZ_CP097793:1766999-1767283 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CFF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CG04 |