Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1166441..1167042 | Replicon | chromosome |
| Accession | NZ_CP097793 | ||
| Organism | Pasteurella multocida strain 21275 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M9417_RS05850 | Protein ID | WP_078819687.1 |
| Coordinates | 1166728..1167042 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M9417_RS05845 | Protein ID | WP_078819686.1 |
| Coordinates | 1166441..1166731 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9417_RS05815 (M9417_05815) | 1161691..1162374 | - | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| M9417_RS05820 (M9417_05820) | 1162426..1162878 | - | 453 | WP_014390720.1 | hypothetical protein | - |
| M9417_RS05825 (M9417_05825) | 1162928..1163125 | - | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| M9417_RS05830 (M9417_05830) | 1163249..1163926 | + | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| M9417_RS05835 (M9417_05835) | 1164137..1165981 | + | 1845 | WP_170356870.1 | DEAD/DEAH box helicase family protein | - |
| M9417_RS05840 (M9417_05840) | 1166011..1166415 | + | 405 | WP_146024473.1 | hypothetical protein | - |
| M9417_RS05845 (M9417_05845) | 1166441..1166731 | - | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| M9417_RS05850 (M9417_05850) | 1166728..1167042 | - | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9417_RS05855 (M9417_05855) | 1167500..1167727 | + | 228 | WP_099821843.1 | hypothetical protein | - |
| M9417_RS05870 (M9417_05870) | 1168615..1168806 | + | 192 | WP_014390714.1 | hypothetical protein | - |
| M9417_RS05875 (M9417_05875) | 1168781..1169158 | + | 378 | WP_014390713.1 | hypothetical protein | - |
| M9417_RS05880 (M9417_05880) | 1169269..1170105 | + | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| M9417_RS05885 (M9417_05885) | 1170390..1171046 | + | 657 | WP_014390711.1 | Bro-N domain-containing protein | - |
| M9417_RS05890 (M9417_05890) | 1171108..1171338 | - | 231 | WP_223251317.1 | hypothetical protein | - |
| M9417_RS05895 (M9417_05895) | 1171486..1171785 | + | 300 | WP_014390709.1 | hypothetical protein | - |
| M9417_RS05900 (M9417_05900) | 1171757..1171993 | + | 237 | WP_250264861.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1135148..1189440 | 54292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T246240 WP_078819687.1 NZ_CP097793:c1167042-1166728 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|