Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 1166441..1167042 Replicon chromosome
Accession NZ_CP097793
Organism Pasteurella multocida strain 21275

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag M9417_RS05850 Protein ID WP_078819687.1
Coordinates 1166728..1167042 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag M9417_RS05845 Protein ID WP_078819686.1
Coordinates 1166441..1166731 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9417_RS05815 (M9417_05815) 1161691..1162374 - 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
M9417_RS05820 (M9417_05820) 1162426..1162878 - 453 WP_014390720.1 hypothetical protein -
M9417_RS05825 (M9417_05825) 1162928..1163125 - 198 WP_014390719.1 helix-turn-helix domain-containing protein -
M9417_RS05830 (M9417_05830) 1163249..1163926 + 678 WP_014390718.1 XRE family transcriptional regulator -
M9417_RS05835 (M9417_05835) 1164137..1165981 + 1845 WP_170356870.1 DEAD/DEAH box helicase family protein -
M9417_RS05840 (M9417_05840) 1166011..1166415 + 405 WP_146024473.1 hypothetical protein -
M9417_RS05845 (M9417_05845) 1166441..1166731 - 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
M9417_RS05850 (M9417_05850) 1166728..1167042 - 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9417_RS05855 (M9417_05855) 1167500..1167727 + 228 WP_099821843.1 hypothetical protein -
M9417_RS05870 (M9417_05870) 1168615..1168806 + 192 WP_014390714.1 hypothetical protein -
M9417_RS05875 (M9417_05875) 1168781..1169158 + 378 WP_014390713.1 hypothetical protein -
M9417_RS05880 (M9417_05880) 1169269..1170105 + 837 WP_014390712.1 KilA-N domain-containing protein -
M9417_RS05885 (M9417_05885) 1170390..1171046 + 657 WP_014390711.1 Bro-N domain-containing protein -
M9417_RS05890 (M9417_05890) 1171108..1171338 - 231 WP_223251317.1 hypothetical protein -
M9417_RS05895 (M9417_05895) 1171486..1171785 + 300 WP_014390709.1 hypothetical protein -
M9417_RS05900 (M9417_05900) 1171757..1171993 + 237 WP_250264861.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1135148..1189440 54292


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T246240 WP_078819687.1 NZ_CP097793:c1167042-1166728 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT246240 WP_078819686.1 NZ_CP097793:c1166731-1166441 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References