Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1137953..1138870 | Replicon | chromosome |
Accession | NZ_CP097784 | ||
Organism | Bacillus velezensis strain V 3.14 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | MF619_RS06190 | Protein ID | WP_025851786.1 |
Coordinates | 1138124..1138870 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | MF619_RS06185 | Protein ID | WP_003154807.1 |
Coordinates | 1137953..1138123 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MF619_RS06145 (MF619_001229) | 1133184..1134806 | + | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
MF619_RS06150 (MF619_001230) | 1134819..1135190 | + | 372 | WP_003154820.1 | XkdW family protein | - |
MF619_RS06155 (MF619_001231) | 1135196..1135393 | + | 198 | WP_003154819.1 | XkdX family protein | - |
MF619_RS06160 (MF619_001232) | 1135450..1136211 | + | 762 | WP_025851792.1 | hypothetical protein | - |
MF619_RS06165 (MF619_001233) | 1136263..1136526 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
MF619_RS06170 (MF619_001234) | 1136540..1136803 | + | 264 | WP_025851790.1 | phage holin | - |
MF619_RS06175 (MF619_001235) | 1136817..1137695 | + | 879 | WP_025851788.1 | N-acetylmuramoyl-L-alanine amidase | - |
MF619_RS06180 (MF619_001236) | 1137731..1137856 | - | 126 | WP_003154809.1 | hypothetical protein | - |
MF619_RS06185 (MF619_001237) | 1137953..1138123 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
MF619_RS06190 (MF619_001238) | 1138124..1138870 | - | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
MF619_RS06195 (MF619_001239) | 1138975..1139973 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
MF619_RS06200 (MF619_001240) | 1139986..1140603 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
MF619_RS06205 (MF619_001241) | 1140889..1142205 | - | 1317 | WP_003154801.1 | amino acid permease | - |
MF619_RS06210 (MF619_001242) | 1142528..1143478 | + | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T246235 WP_025851786.1 NZ_CP097784:c1138870-1138124 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|