Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 385478..386115 | Replicon | chromosome |
Accession | NZ_CP097784 | ||
Organism | Bacillus velezensis strain V 3.14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | MF619_RS02175 | Protein ID | WP_003156187.1 |
Coordinates | 385765..386115 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | MF619_RS02170 | Protein ID | WP_003156188.1 |
Coordinates | 385478..385759 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MF619_RS02150 (MF619_000429) | 381844..382443 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
MF619_RS02155 (MF619_000430) | 382536..382901 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
MF619_RS02160 (MF619_000431) | 383065..384072 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
MF619_RS02165 (MF619_000432) | 384189..385358 | + | 1170 | WP_025853726.1 | alanine racemase | - |
MF619_RS02170 (MF619_000433) | 385478..385759 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
MF619_RS02175 (MF619_000434) | 385765..386115 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
MF619_RS02180 (MF619_000435) | 386233..387054 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
MF619_RS02185 (MF619_000436) | 387059..387424 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
MF619_RS02190 (MF619_000437) | 387427..387828 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
MF619_RS02195 (MF619_000438) | 387840..388847 | + | 1008 | WP_025853725.1 | PP2C family protein-serine/threonine phosphatase | - |
MF619_RS02200 (MF619_000439) | 388911..389240 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
MF619_RS02205 (MF619_000440) | 389237..389719 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
MF619_RS02210 (MF619_000441) | 389685..390473 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
MF619_RS02215 (MF619_000442) | 390473..391075 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T246234 WP_003156187.1 NZ_CP097784:385765-386115 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|