Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1067667..1068584 | Replicon | chromosome |
Accession | NZ_CP097779 | ||
Organism | Bacillus velezensis strain R 4.6 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | MF621_RS05555 | Protein ID | WP_025851786.1 |
Coordinates | 1067838..1068584 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | MF621_RS05550 | Protein ID | WP_003154807.1 |
Coordinates | 1067667..1067837 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MF621_RS05510 (MF621_001101) | 1062898..1064520 | + | 1623 | WP_003154821.1 | pyocin knob domain-containing protein | - |
MF621_RS05515 (MF621_001102) | 1064533..1064904 | + | 372 | WP_003154820.1 | XkdW family protein | - |
MF621_RS05520 (MF621_001103) | 1064910..1065107 | + | 198 | WP_003154819.1 | XkdX family protein | - |
MF621_RS05525 (MF621_001104) | 1065164..1065925 | + | 762 | WP_025851792.1 | hypothetical protein | - |
MF621_RS05530 (MF621_001105) | 1065977..1066240 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
MF621_RS05535 (MF621_001106) | 1066254..1066517 | + | 264 | WP_025851790.1 | phage holin | - |
MF621_RS05540 (MF621_001107) | 1066531..1067409 | + | 879 | WP_025851788.1 | N-acetylmuramoyl-L-alanine amidase | - |
MF621_RS05545 (MF621_001108) | 1067445..1067570 | - | 126 | WP_003154809.1 | hypothetical protein | - |
MF621_RS05550 (MF621_001109) | 1067667..1067837 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
MF621_RS05555 (MF621_001110) | 1067838..1068584 | - | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
MF621_RS05560 (MF621_001111) | 1068689..1069687 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
MF621_RS05565 (MF621_001112) | 1069700..1070317 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
MF621_RS05570 (MF621_001113) | 1070603..1071919 | - | 1317 | WP_003154801.1 | amino acid permease | - |
MF621_RS05575 (MF621_001114) | 1072242..1073192 | + | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T246233 WP_025851786.1 NZ_CP097779:c1068584-1067838 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|