Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 315191..315828 | Replicon | chromosome |
| Accession | NZ_CP097779 | ||
| Organism | Bacillus velezensis strain R 4.6 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | MF621_RS01530 | Protein ID | WP_003156187.1 |
| Coordinates | 315478..315828 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | MF621_RS01525 | Protein ID | WP_003156188.1 |
| Coordinates | 315191..315472 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MF621_RS01505 (MF621_000301) | 311557..312156 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| MF621_RS01510 (MF621_000302) | 312249..312614 | + | 366 | WP_003156192.1 | holo-ACP synthase | - |
| MF621_RS01515 (MF621_000303) | 312778..313785 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
| MF621_RS01520 (MF621_000304) | 313902..315071 | + | 1170 | WP_025853726.1 | alanine racemase | - |
| MF621_RS01525 (MF621_000305) | 315191..315472 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| MF621_RS01530 (MF621_000306) | 315478..315828 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| MF621_RS01535 (MF621_000307) | 315946..316767 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
| MF621_RS01540 (MF621_000308) | 316772..317137 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| MF621_RS01545 (MF621_000309) | 317140..317541 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| MF621_RS01550 (MF621_000310) | 317553..318560 | + | 1008 | WP_025853725.1 | PP2C family protein-serine/threonine phosphatase | - |
| MF621_RS01555 (MF621_000311) | 318624..318953 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| MF621_RS01560 (MF621_000312) | 318950..319432 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| MF621_RS01565 (MF621_000313) | 319398..320186 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| MF621_RS01570 (MF621_000314) | 320186..320788 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T246232 WP_003156187.1 NZ_CP097779:315478-315828 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|