Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 1459371..1460009 | Replicon | chromosome |
Accession | NZ_CP097778 | ||
Organism | Paenibacillus polymyxa strain K 1.14 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | H6CFY1 |
Locus tag | MF622_RS06735 | Protein ID | WP_007429335.1 |
Coordinates | 1459659..1460009 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | H6CFY0 |
Locus tag | MF622_RS06730 | Protein ID | WP_007429334.1 |
Coordinates | 1459371..1459652 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MF622_RS06715 (MF622_001339) | 1455872..1456018 | - | 147 | WP_250243792.1 | hypothetical protein | - |
MF622_RS06720 (MF622_001340) | 1456335..1457612 | + | 1278 | WP_250243794.1 | DUF4367 domain-containing protein | - |
MF622_RS06725 (MF622_001341) | 1457881..1459077 | + | 1197 | WP_250243797.1 | alanine racemase | - |
MF622_RS06730 (MF622_001342) | 1459371..1459652 | + | 282 | WP_007429334.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MF622_RS06735 (MF622_001343) | 1459659..1460009 | + | 351 | WP_007429335.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MF622_RS06740 (MF622_001344) | 1460189..1462411 | + | 2223 | WP_250245180.1 | Tex family protein | - |
MF622_RS06745 (MF622_001345) | 1462517..1462651 | - | 135 | WP_007429337.1 | cortex morphogenetic protein CmpA | - |
MF622_RS06750 (MF622_001346) | 1462796..1463320 | + | 525 | WP_250243800.1 | SprT family protein | - |
MF622_RS06765 (MF622_001349) | 1463709..1464584 | - | 876 | WP_250243802.1 | Cof-type HAD-IIB family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12822.77 Da Isoelectric Point: 5.6195
>T246231 WP_007429335.1 NZ_CP097778:1459659-1460009 [Paenibacillus polymyxa]
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|