Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 4477681..4478319 | Replicon | chromosome |
Accession | NZ_CP097775 | ||
Organism | Paenibacillus polymyxa strain O 1.27 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | H6CFY1 |
Locus tag | MF623_RS19620 | Protein ID | WP_007429335.1 |
Coordinates | 4477969..4478319 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | H6CFY0 |
Locus tag | MF623_RS19615 | Protein ID | WP_007429334.1 |
Coordinates | 4477681..4477962 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MF623_RS19595 (MF623_003907) | 4472697..4473668 | - | 972 | WP_107733997.1 | ABC transporter substrate-binding protein | - |
MF623_RS19600 (MF623_003908) | 4473903..4474535 | + | 633 | WP_016821167.1 | LysE family transporter | - |
MF623_RS19605 (MF623_003909) | 4474646..4475923 | + | 1278 | WP_017426524.1 | outer membrane lipoprotein-sorting protein | - |
MF623_RS19610 (MF623_003910) | 4476191..4477387 | + | 1197 | WP_026065391.1 | alanine racemase | - |
MF623_RS19615 (MF623_003911) | 4477681..4477962 | + | 282 | WP_007429334.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MF623_RS19620 (MF623_003912) | 4477969..4478319 | + | 351 | WP_007429335.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MF623_RS19625 (MF623_003913) | 4478498..4480720 | + | 2223 | WP_017426526.1 | Tex family protein | - |
MF623_RS19630 (MF623_003914) | 4480824..4480958 | - | 135 | WP_016821163.1 | cortex morphogenetic protein CmpA | - |
MF623_RS19635 (MF623_003915) | 4481101..4481613 | + | 513 | WP_016821162.1 | SprT family protein | - |
MF623_RS19650 (MF623_003918) | 4481992..4482867 | - | 876 | WP_017426527.1 | Cof-type HAD-IIB family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12822.77 Da Isoelectric Point: 5.6195
>T246230 WP_007429335.1 NZ_CP097775:4477969-4478319 [Paenibacillus polymyxa]
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAATHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDEETMRKVSDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|