Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 97200..97747 Replicon plasmid pMS1050-2
Accession NZ_CP097728
Organism Escherichia coli strain MS1050

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag M9O78_RS25390 Protein ID WP_001384452.1
Coordinates 97200..97478 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID K4JYR0
Locus tag M9O78_RS25395 Protein ID WP_000079928.1
Coordinates 97478..97747 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O78_RS25355 (92211) 92211..92453 + 243 WP_000844627.1 transposase -
M9O78_RS25360 (92485) 92485..93135 - 651 WP_000164043.1 tetracycline resistance transcriptional repressor TetR(A) -
M9O78_RS25365 (93241) 93241..94440 + 1200 WP_000804064.1 tetracycline efflux MFS transporter Tet(A) -
M9O78_RS25370 (94472) 94472..95332 - 861 WP_000493383.1 EamA family transporter -
M9O78_RS25375 (95341) 95341..95955 - 615 Protein_104 helix-turn-helix domain-containing protein -
M9O78_RS25380 (95950) 95950..96075 + 126 Protein_105 MerR family transcriptional regulator -
M9O78_RS25385 (96312) 96312..97160 - 849 WP_001057996.1 3'-5' exonuclease -
M9O78_RS25390 (97200) 97200..97478 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
M9O78_RS25395 (97478) 97478..97747 - 270 WP_000079928.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
M9O78_RS25400 (97802) 97802..97960 - 159 WP_000841008.1 hypothetical protein -
M9O78_RS25405 (98656) 98656..99687 - 1032 WP_000907875.1 plasmid replication initiator RepA -
M9O78_RS25410 (100645) 100645..100923 + 279 WP_219065241.1 ash family protein -
M9O78_RS25415 (100841) 100841..101128 + 288 WP_000074849.1 conjugal transfer protein TraA -
M9O78_RS25420 (101570) 101570..102103 + 534 WP_001303319.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) - 1..117915 117915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T246227 WP_001384452.1 NZ_CP097728:c97478-97200 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10175.50 Da        Isoelectric Point: 7.3210

>AT246227 WP_000079928.1 NZ_CP097728:c97747-97478 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A5W2J4D0

References