Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 146364..146889 Replicon plasmid pMS1050-1
Accession NZ_CP097727
Organism Escherichia coli strain MS1050

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag M9O78_RS24490 Protein ID WP_001159871.1
Coordinates 146584..146889 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag M9O78_RS24485 Protein ID WP_000813630.1
Coordinates 146364..146582 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O78_RS24465 (143336) 143336..143752 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
M9O78_RS24470 (143749) 143749..143979 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
M9O78_RS24475 (144398) 144398..145087 + 690 WP_001513524.1 RES family NAD+ phosphorylase -
M9O78_RS24480 (145119) 145119..145808 - 690 WP_001513525.1 helix-turn-helix domain-containing protein -
M9O78_RS24485 (146364) 146364..146582 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9O78_RS24490 (146584) 146584..146889 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
M9O78_RS24495 (146890) 146890..147672 + 783 WP_001513526.1 site-specific integrase -
M9O78_RS24500 (148372) 148372..148545 + 174 Protein_150 RepB family plasmid replication initiator protein -
M9O78_RS24510 (149941) 149941..150387 + 447 WP_053270998.1 hypothetical protein -
M9O78_RS24515 (150483) 150483..150740 - 258 WP_015387373.1 hypothetical protein -
M9O78_RS24520 (151469) 151469..151681 + 213 WP_001523378.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..203859 203859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T246219 WP_001159871.1 NZ_CP097727:146584-146889 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT246219 WP_000813630.1 NZ_CP097727:146364-146582 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References