Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 11936..12471 Replicon plasmid pMS1050-1
Accession NZ_CP097727
Organism Escherichia coli strain MS1050

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag M9O78_RS23815 Protein ID WP_000222760.1
Coordinates 12184..12471 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag M9O78_RS23810 Protein ID WP_001132900.1
Coordinates 11936..12187 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O78_RS23765 (7059) 7059..7619 + 561 WP_032072881.1 fertility inhibition protein FinO -
M9O78_RS23770 (7755) 7755..7967 + 213 WP_001299730.1 ANR family transcriptional regulator -
M9O78_RS23775 (8213) 8213..8287 + 75 Protein_5 endonuclease -
- (8543) 8543..8604 - 62 NuclAT_1 - -
- (8543) 8543..8604 - 62 NuclAT_1 - -
- (8543) 8543..8604 - 62 NuclAT_1 - -
- (8543) 8543..8604 - 62 NuclAT_1 - -
M9O78_RS23780 (8648) 8648..8797 + 150 WP_001312851.1 Hok/Gef family protein -
M9O78_RS23785 (9081) 9081..9338 + 258 WP_000083845.1 replication regulatory protein RepA -
M9O78_RS23790 (9355) 9355..9606 - 252 WP_223195197.1 replication protein RepA -
M9O78_RS23795 (9597) 9597..9644 + 48 WP_229471593.1 hypothetical protein -
M9O78_RS23800 (9637) 9637..10119 + 483 WP_001273588.1 hypothetical protein -
M9O78_RS23805 (10112) 10112..10969 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
M9O78_RS23810 (11936) 11936..12187 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9O78_RS23815 (12184) 12184..12471 + 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O78_RS23820 (12575) 12575..12895 + 321 Protein_14 serine acetyltransferase -
M9O78_RS23825 (12911) 12911..13258 - 348 Protein_15 IS1-like element IS1A family transposase -
M9O78_RS23830 (13347) 13347..14369 + 1023 WP_267327066.1 IS21-like element IS100 family transposase -
M9O78_RS23835 (14366) 14366..15148 + 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
M9O78_RS23840 (15203) 15203..15567 - 365 Protein_18 IS1 family transposase -
M9O78_RS23845 (15667) 15667..16870 + 1204 Protein_19 ISL3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..203859 203859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T246216 WP_000222760.1 NZ_CP097727:12184-12471 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT246216 WP_001132900.1 NZ_CP097727:11936-12187 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References