Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4471806..4472607 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | M9O78_RS21325 | Protein ID | WP_001094436.1 |
Coordinates | 4472230..4472607 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | M9O78_RS21320 | Protein ID | WP_015953067.1 |
Coordinates | 4471806..4472183 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS21285 (4467718) | 4467718..4468398 | + | 681 | WP_001593697.1 | WYL domain-containing protein | - |
M9O78_RS21290 (4468546) | 4468546..4469223 | + | 678 | WP_001097312.1 | hypothetical protein | - |
M9O78_RS21295 (4469229) | 4469229..4469462 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
M9O78_RS21300 (4469552) | 4469552..4470370 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
M9O78_RS21305 (4470461) | 4470461..4470946 | + | 486 | WP_000860054.1 | antirestriction protein | - |
M9O78_RS21310 (4470961) | 4470961..4471437 | + | 477 | WP_143365369.1 | RadC family protein | - |
M9O78_RS21315 (4471506) | 4471506..4471727 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
M9O78_RS21320 (4471806) | 4471806..4472183 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
M9O78_RS21325 (4472230) | 4472230..4472607 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
M9O78_RS21330 (4472604) | 4472604..4473092 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
M9O78_RS21335 (4473104) | 4473104..4473301 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
M9O78_RS21340 (4473386) | 4473386..4474231 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
M9O78_RS21345 (4474302) | 4474302..4475837 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T246211 WP_001094436.1 NZ_CP097726:4472230-4472607 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT246211 WP_015953067.1 NZ_CP097726:4471806-4472183 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |