Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4204375..4205189 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M9O78_RS19930 | Protein ID | WP_001054376.1 |
Coordinates | 4204375..4204632 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | M9O78_RS19935 | Protein ID | WP_001309181.1 |
Coordinates | 4204644..4205189 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS19905 (4199663) | 4199663..4200769 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
M9O78_RS19910 (4200834) | 4200834..4201814 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M9O78_RS19915 (4201924) | 4201924..4202129 | + | 206 | Protein_3899 | HNH endonuclease | - |
M9O78_RS19920 (4202397) | 4202397..4203637 | - | 1241 | Protein_3900 | helicase YjhR | - |
M9O78_RS19925 (4203753) | 4203753..4203884 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M9O78_RS19930 (4204375) | 4204375..4204632 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M9O78_RS19935 (4204644) | 4204644..4205189 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
M9O78_RS19940 (4205245) | 4205245..4205991 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M9O78_RS19945 (4206160) | 4206160..4206378 | + | 219 | Protein_3905 | hypothetical protein | - |
M9O78_RS19950 (4206416) | 4206416..4206532 | + | 117 | Protein_3906 | VOC family protein | - |
M9O78_RS19955 (4206777) | 4206777..4207898 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M9O78_RS19960 (4207895) | 4207895..4208173 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M9O78_RS19965 (4208185) | 4208185..4209498 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4196869..4213413 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T246210 WP_001054376.1 NZ_CP097726:4204375-4204632 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT246210 WP_001309181.1 NZ_CP097726:4204644-4205189 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|