Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3150769..3151474 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M9O78_RS15025 | Protein ID | WP_000539521.1 |
Coordinates | 3150769..3151155 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M9O78_RS15030 | Protein ID | WP_001280945.1 |
Coordinates | 3151145..3151474 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS15005 (3146773) | 3146773..3147399 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M9O78_RS15010 (3147396) | 3147396..3148511 | - | 1116 | WP_000555038.1 | aldose sugar dehydrogenase YliI | - |
M9O78_RS15015 (3148622) | 3148622..3149005 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M9O78_RS15020 (3149218) | 3149218..3150543 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M9O78_RS15025 (3150769) | 3150769..3151155 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9O78_RS15030 (3151145) | 3151145..3151474 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M9O78_RS15035 (3151544) | 3151544..3152872 | - | 1329 | WP_000086879.1 | GGDEF domain-containing protein | - |
M9O78_RS15040 (3152880) | 3152880..3155228 | - | 2349 | WP_001322378.1 | EAL domain-containing protein | - |
M9O78_RS15045 (3155406) | 3155406..3156317 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T246207 WP_000539521.1 NZ_CP097726:3150769-3151155 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|