Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2903622..2904406 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | M9O78_RS13855 | Protein ID | WP_000613626.1 |
Coordinates | 2903912..2904406 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | M9O78_RS13850 | Protein ID | WP_001110447.1 |
Coordinates | 2903622..2903915 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS13840 (2898772) | 2898772..2899731 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
M9O78_RS13845 (2900304) | 2900304..2903489 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
M9O78_RS13850 (2903622) | 2903622..2903915 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
M9O78_RS13855 (2903912) | 2903912..2904406 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
M9O78_RS13860 (2904501) | 2904501..2905454 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
M9O78_RS13865 (2905466) | 2905466..2907109 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
M9O78_RS13870 (2907175) | 2907175..2908116 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M9O78_RS13875 (2908116) | 2908116..2909213 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T246206 WP_000613626.1 NZ_CP097726:2903912-2904406 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|