Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2603567..2604205 | Replicon | chromosome |
| Accession | NZ_CP097726 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | M9O78_RS12385 | Protein ID | WP_000813797.1 |
| Coordinates | 2604029..2604205 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M9O78_RS12380 | Protein ID | WP_076611057.1 |
| Coordinates | 2603567..2603983 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS12360 (2598719) | 2598719..2599660 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
| M9O78_RS12365 (2599661) | 2599661..2600674 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
| M9O78_RS12370 (2600692) | 2600692..2601837 | - | 1146 | WP_000047447.1 | ABC transporter substrate-binding protein | - |
| M9O78_RS12375 (2602082) | 2602082..2603488 | - | 1407 | WP_000760613.1 | PLP-dependent aminotransferase family protein | - |
| M9O78_RS12380 (2603567) | 2603567..2603983 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M9O78_RS12385 (2604029) | 2604029..2604205 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M9O78_RS12390 (2604427) | 2604427..2604657 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| M9O78_RS12395 (2604749) | 2604749..2606710 | - | 1962 | WP_001309488.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M9O78_RS12400 (2606783) | 2606783..2607319 | - | 537 | WP_000429161.1 | DNA-binding transcriptional regulator SutR | - |
| M9O78_RS12405 (2607411) | 2607411..2608583 | + | 1173 | WP_001236223.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T246205 WP_000813797.1 NZ_CP097726:c2604205-2604029 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT246205 WP_076611057.1 NZ_CP097726:c2603983-2603567 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|