Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 968909..969563 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | M9O78_RS04665 | Protein ID | WP_000244765.1 |
Coordinates | 969156..969563 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M9O78_RS04660 | Protein ID | WP_000354046.1 |
Coordinates | 968909..969175 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS04640 (964997) | 964997..966430 | - | 1434 | WP_063082439.1 | 6-phospho-beta-glucosidase BglA | - |
M9O78_RS04645 (966475) | 966475..966786 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
M9O78_RS04650 (966950) | 966950..967609 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9O78_RS04655 (967686) | 967686..968666 | - | 981 | WP_049038218.1 | tRNA-modifying protein YgfZ | - |
M9O78_RS04660 (968909) | 968909..969175 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M9O78_RS04665 (969156) | 969156..969563 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
M9O78_RS04670 (969603) | 969603..970124 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M9O78_RS04675 (970236) | 970236..971132 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M9O78_RS04680 (971157) | 971157..971867 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9O78_RS04685 (971873) | 971873..973606 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T246197 WP_000244765.1 NZ_CP097726:969156-969563 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |