Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 834421..835256 | Replicon | chromosome |
| Accession | NZ_CP097726 | ||
| Organism | Escherichia coli strain MS1050 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q707F1 |
| Locus tag | M9O78_RS04015 | Protein ID | WP_001094445.1 |
| Coordinates | 834421..834798 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | M9O78_RS04020 | Protein ID | WP_024174331.1 |
| Coordinates | 834888..835256 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O78_RS03990 (830493) | 830493..831476 | - | 984 | WP_001355482.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| M9O78_RS03995 (832287) | 832287..832457 | - | 171 | Protein_785 | IS110 family transposase | - |
| M9O78_RS04000 (832800) | 832800..833642 | - | 843 | WP_001280499.1 | DUF4942 domain-containing protein | - |
| M9O78_RS04005 (833727) | 833727..833924 | - | 198 | WP_000838536.1 | DUF957 domain-containing protein | - |
| M9O78_RS04010 (833936) | 833936..834424 | - | 489 | WP_000761717.1 | DUF5983 family protein | - |
| M9O78_RS04015 (834421) | 834421..834798 | - | 378 | WP_001094445.1 | TA system toxin CbtA family protein | Toxin |
| M9O78_RS04020 (834888) | 834888..835256 | - | 369 | WP_024174331.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M9O78_RS04025 (835330) | 835330..835551 | - | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| M9O78_RS04030 (835620) | 835620..836096 | - | 477 | WP_001384029.1 | RadC family protein | - |
| M9O78_RS04035 (836112) | 836112..836597 | - | 486 | WP_021538211.1 | antirestriction protein | - |
| M9O78_RS04040 (836689) | 836689..837507 | - | 819 | WP_021548586.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 832287..832442 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14194.10 Da Isoelectric Point: 6.8518
>T246196 WP_001094445.1 NZ_CP097726:c834798-834421 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRMVNNITQGKHPEAQQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13603.42 Da Isoelectric Point: 6.7386
>AT246196 WP_024174331.1 NZ_CP097726:c835256-834888 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|