Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 148760..149372 | Replicon | chromosome |
Accession | NZ_CP097726 | ||
Organism | Escherichia coli strain MS1050 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | M9O78_RS00635 | Protein ID | WP_000833473.1 |
Coordinates | 148760..148945 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | M9O78_RS00640 | Protein ID | WP_000499744.1 |
Coordinates | 148962..149372 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O78_RS00625 (145592) | 145592..146743 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
M9O78_RS00630 (146944) | 146944..148482 | + | 1539 | WP_001309845.1 | aldehyde dehydrogenase AldB | - |
M9O78_RS00635 (148760) | 148760..148945 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M9O78_RS00640 (148962) | 148962..149372 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M9O78_RS00645 (149444) | 149444..151408 | - | 1965 | WP_001026861.1 | glycoside hydrolase family 127 protein | - |
M9O78_RS00650 (151419) | 151419..152819 | - | 1401 | WP_000204802.1 | MFS transporter | - |
M9O78_RS00655 (153045) | 153045..153860 | + | 816 | WP_000891825.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T246192 WP_000833473.1 NZ_CP097726:148760-148945 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT246192 WP_000499744.1 NZ_CP097726:148962-149372 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|