Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 1..42330 Replicon plasmid pMS1494-1
Accession NZ_CP097725
Organism Escherichia coli strain MS1494

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M9O75_RS23180 Protein ID WP_000220560.1
Coordinates 1..282 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M9O75_RS23175 Protein ID WP_000121743.1
Coordinates 42330..11 (+) Length -14106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O75_RS23180 (M9O75_23180) 1..282 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O75_RS23185 (M9O75_23185) 428..751 + 324 WP_001181903.1 hypothetical protein -
M9O75_RS23190 (M9O75_23190) 796..1041 + 246 WP_000356546.1 hypothetical protein -
M9O75_RS23195 (M9O75_23195) 1031..1246 + 216 WP_001180116.1 hypothetical protein -
M9O75_RS23200 (M9O75_23200) 1339..1668 + 330 WP_000866648.1 hypothetical protein -
M9O75_RS23205 (M9O75_23205) 1955..2104 + 150 WP_000003880.1 hypothetical protein -
M9O75_RS23210 (M9O75_23210) 2117..2389 + 273 WP_000160399.1 hypothetical protein -
M9O75_RS23215 (M9O75_23215) 2716..3261 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
M9O75_RS23220 (M9O75_23220) 3264..4421 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
M9O75_RS23225 (M9O75_23225) 4782..5273 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -
M9O75_RS23230 (M9O75_23230) 5498..6142 + 645 WP_000953539.1 lytic transglycosylase domain-containing protein -
M9O75_RS23235 (M9O75_23235) 6126..6416 + 291 WP_000921916.1 TrbC/VirB2 family protein -
M9O75_RS23240 (M9O75_23240) 6440..9199 + 2760 WP_000108725.1 VirB3 family type IV secretion system protein -
M9O75_RS23245 (M9O75_23245) 9201..9938 + 738 WP_000737859.1 type IV secretion system protein -
M9O75_RS23250 (M9O75_23250) 9948..10208 + 261 WP_001228869.1 EexN family lipoprotein -
M9O75_RS23255 (M9O75_23255) 10220..11275 + 1056 WP_000235774.1 type IV secretion system protein -
M9O75_RS23260 (M9O75_23260) 11465..12187 + 723 WP_000394570.1 type IV secretion system protein -
M9O75_RS23265 (M9O75_23265) 12193..13122 + 930 WP_000776689.1 TrbG/VirB9 family P-type conjugative transfer protein -
M9O75_RS23270 (M9O75_23270) 13119..14333 + 1215 WP_001295061.1 VirB10/TraB/TrbI family type IV secretion system protein -
M9O75_RS23275 (M9O75_23275) 14351..15388 + 1038 WP_000217791.1 P-type DNA transfer ATPase VirB11 -
M9O75_RS23280 (M9O75_23280) 15393..17228 + 1836 WP_000053826.1 type IV secretory system conjugative DNA transfer family protein -
M9O75_RS23285 (M9O75_23285) 17225..17620 + 396 WP_000733627.1 cag pathogenicity island Cag12 family protein -
M9O75_RS23290 (M9O75_23290) 17623..17955 + 333 WP_000699980.1 hypothetical protein -
M9O75_RS23295 (M9O75_23295) 18198..19013 + 816 WP_000018321.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
M9O75_RS23300 (M9O75_23300) 19167..20075 - 909 WP_000174819.1 C45 family peptidase -
M9O75_RS23305 (M9O75_23305) 20222..20308 + 87 Protein_26 micrococcal nuclease -
M9O75_RS23310 (M9O75_23310) 20723..20968 + 246 WP_001243650.1 hypothetical protein -
M9O75_RS23315 (M9O75_23315) 20988..23312 + 2325 WP_001235773.1 type IA DNA topoisomerase -
M9O75_RS23320 (M9O75_23320) 23324..23773 + 450 WP_001282381.1 H-NS family nucleoid-associated regulatory protein -
M9O75_RS23325 (M9O75_23325) 23836..24240 + 405 WP_000059893.1 hypothetical protein -
M9O75_RS23330 (M9O75_23330) 24394..25785 - 1392 WP_001493761.1 ISKra4-like element ISKpn19 family transposase -
M9O75_RS23335 (M9O75_23335) 25822..26394 - 573 WP_001493762.1 recombinase family protein -
M9O75_RS23340 (M9O75_23340) 26531..27076 - 546 WP_001493763.1 plasmid pRiA4b ORF-3 family protein -
M9O75_RS23345 (M9O75_23345) 27239..27457 + 219 WP_132035796.1 relaxase -
M9O75_RS23350 (M9O75_23350) 27489..28139 - 651 WP_001493764.1 tetracycline resistance transcriptional repressor TetR(A) -
M9O75_RS23355 (M9O75_23355) 28245..29444 + 1200 WP_001493765.1 tetracycline efflux MFS transporter Tet(A) -
M9O75_RS23360 (M9O75_23360) 29476..30360 - 885 WP_000058717.1 EamA family transporter -
M9O75_RS23365 (M9O75_23365) 30498..30890 - 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
M9O75_RS23370 (M9O75_23370) 30894..32171 + 1278 Protein_39 Tn3-like element TnAs1 family transposase -
M9O75_RS23375 (M9O75_23375) 32266..32454 + 189 WP_000957857.1 hypothetical protein -
M9O75_RS23380 (M9O75_23380) 32464..33663 + 1200 WP_000948429.1 IS91 family transposase -
M9O75_RS23385 (M9O75_23385) 33954..34142 + 189 WP_000957857.1 hypothetical protein -
M9O75_RS23390 (M9O75_23390) 34152..35350 + 1199 WP_267326382.1 IS91 family transposase -
M9O75_RS23395 (M9O75_23395) 35520..36020 + 501 Protein_44 Tn3 family transposase -
M9O75_RS23400 (M9O75_23400) 36119..36757 - 639 WP_024245155.1 recombinase family protein -
M9O75_RS23405 (M9O75_23405) 37043..37663 + 621 WP_000864791.1 ParA family protein -
M9O75_RS23410 (M9O75_23410) 37715..37945 + 231 WP_000051064.1 plasmid partition protein ParG -
M9O75_RS23415 (M9O75_23415) 37961..38254 + 294 WP_015060510.1 hypothetical protein -
M9O75_RS23420 (M9O75_23420) 38256..39224 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
M9O75_RS23425 (M9O75_23425) 39284..39637 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
M9O75_RS23430 (M9O75_23430) 39774..40220 - 447 WP_001074386.1 hypothetical protein -
M9O75_RS23435 (M9O75_23435) 40260..41096 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / tet(A) - 1..42570 42570


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T246191 WP_000220560.1 NZ_CP097725:1-282 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: -14106 a.a.        Molecular weight: Da        Isoelectric Point:

>AT246191 WP_000121743.1 NZ_CP097725:42330-11 [Escherichia coli]

Download         Length: -42318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References