Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3877554..3878104 Replicon chromosome
Accession NZ_CP097724
Organism Escherichia coli strain MS1494

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M9O75_RS18745 Protein ID WP_001160966.1
Coordinates 3877554..3877868 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M9O75_RS18750 Protein ID WP_000125566.1
Coordinates 3877871..3878104 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O75_RS18720 (3873229) 3873229..3874515 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M9O75_RS18725 (3874515) 3874515..3875504 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M9O75_RS18730 (3875501) 3875501..3876322 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M9O75_RS18735 (3876325) 3876325..3876702 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M9O75_RS18740 (3876709) 3876709..3877557 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M9O75_RS18745 (3877554) 3877554..3877868 - 315 WP_001160966.1 CcdB family protein Toxin
M9O75_RS18750 (3877871) 3877871..3878104 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M9O75_RS18755 (3878190) 3878190..3878669 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M9O75_RS18760 (3878861) 3878861..3880723 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
M9O75_RS18765 (3880716) 3880716..3881111 - 396 Protein_3675 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M9O75_RS18770 (3881297) 3881297..3881458 + 162 WP_001571575.1 hypothetical protein -
M9O75_RS18775 (3881462) 3881462..3882094 - 633 WP_000460689.1 hypothetical protein -
M9O75_RS18780 (3882209) 3882209..3882607 - 399 WP_001281696.1 Mor transcription activator family protein -
M9O75_RS18785 (3882579) 3882579..3883028 - 450 WP_001299262.1 regulatory protein GemA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3875501..3918748 43247


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T246187 WP_001160966.1 NZ_CP097724:c3877868-3877554 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT246187 WP_000125566.1 NZ_CP097724:c3878104-3877871 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References