Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3438156..3438774 | Replicon | chromosome |
Accession | NZ_CP097724 | ||
Organism | Escherichia coli strain MS1494 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M9O75_RS16685 | Protein ID | WP_001291435.1 |
Coordinates | 3438556..3438774 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M9O75_RS16680 | Protein ID | WP_000344800.1 |
Coordinates | 3438156..3438530 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O75_RS16670 (3433246) | 3433246..3434439 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M9O75_RS16675 (3434462) | 3434462..3437611 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M9O75_RS16680 (3438156) | 3438156..3438530 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M9O75_RS16685 (3438556) | 3438556..3438774 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M9O75_RS16690 (3438947) | 3438947..3439498 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
M9O75_RS16695 (3439614) | 3439614..3440084 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M9O75_RS16700 (3440248) | 3440248..3441798 | + | 1551 | WP_001468081.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M9O75_RS16705 (3441840) | 3441840..3442193 | - | 354 | WP_000878142.1 | DUF1428 family protein | - |
M9O75_RS16715 (3442572) | 3442572..3442883 | + | 312 | WP_000409908.1 | MGMT family protein | - |
M9O75_RS16720 (3442914) | 3442914..3443486 | - | 573 | WP_000779844.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246186 WP_001291435.1 NZ_CP097724:3438556-3438774 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT246186 WP_000344800.1 NZ_CP097724:3438156-3438530 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |