Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 23587..24109 Replicon plasmid pMS1665-2
Accession NZ_CP097723
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M9O79_RS23600 Protein ID WP_000220560.1
Coordinates 23828..24109 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M9O79_RS23595 Protein ID WP_000121743.1
Coordinates 23587..23838 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS23565 (M9O79_23565) 18972..19202 + 231 WP_000051064.1 plasmid partition protein ParG -
M9O79_RS23570 (M9O79_23570) 19218..19511 + 294 WP_015060510.1 hypothetical protein -
M9O79_RS23575 (M9O79_23575) 19513..20481 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
M9O79_RS23580 (M9O79_23580) 20541..20894 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
M9O79_RS23585 (M9O79_23585) 21031..21477 - 447 WP_001074386.1 hypothetical protein -
M9O79_RS23590 (M9O79_23590) 21517..22353 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
M9O79_RS23595 (M9O79_23595) 23587..23838 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M9O79_RS23600 (M9O79_23600) 23828..24109 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O79_RS23605 (M9O79_23605) 24255..24578 + 324 WP_001181903.1 hypothetical protein -
M9O79_RS23610 (M9O79_23610) 24623..24868 + 246 WP_000356546.1 hypothetical protein -
M9O79_RS23615 (M9O79_23615) 24858..25073 + 216 WP_001180116.1 hypothetical protein -
M9O79_RS23620 (M9O79_23620) 25166..25495 + 330 WP_000866648.1 hypothetical protein -
M9O79_RS23625 (M9O79_23625) 25782..25931 + 150 WP_000003880.1 hypothetical protein -
M9O79_RS23630 (M9O79_23630) 25944..26216 + 273 WP_000160399.1 hypothetical protein -
M9O79_RS23635 (M9O79_23635) 26543..27088 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
M9O79_RS23640 (M9O79_23640) 27091..28248 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
M9O79_RS23645 (M9O79_23645) 28609..29100 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / tet(A) - 1..39219 39219


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T246174 WP_000220560.1 NZ_CP097723:23828-24109 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT246174 WP_000121743.1 NZ_CP097723:23587-23838 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References