Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 115756..116281 Replicon plasmid pMS1665-1
Accession NZ_CP097722
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag M9O79_RS23155 Protein ID WP_001159871.1
Coordinates 115976..116281 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag M9O79_RS23150 Protein ID WP_000813630.1
Coordinates 115756..115974 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS23130 (112728) 112728..113144 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
M9O79_RS23135 (113141) 113141..113371 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
M9O79_RS23140 (113790) 113790..114479 + 690 WP_001513524.1 RES family NAD+ phosphorylase -
M9O79_RS23145 (114511) 114511..115200 - 690 WP_001513525.1 helix-turn-helix domain-containing protein -
M9O79_RS23150 (115756) 115756..115974 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9O79_RS23155 (115976) 115976..116281 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
M9O79_RS23160 (116282) 116282..117064 + 783 WP_001513526.1 site-specific integrase -
M9O79_RS23165 (117764) 117764..117937 + 174 Protein_114 RepB family plasmid replication initiator protein -
M9O79_RS23175 (119333) 119333..119779 + 447 WP_000616196.1 hypothetical protein -
M9O79_RS23180 (119875) 119875..120132 - 258 WP_015387373.1 hypothetical protein -
M9O79_RS23185 (120861) 120861..121073 + 213 WP_001523378.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aph(3'')-Ib / aph(6)-Id / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..161324 161324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T246173 WP_001159871.1 NZ_CP097722:115976-116281 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT246173 WP_000813630.1 NZ_CP097722:115756-115974 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References