Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 112728..113371 Replicon plasmid pMS1665-1
Accession NZ_CP097722
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag M9O79_RS23130 Protein ID WP_001044768.1
Coordinates 112728..113144 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag M9O79_RS23135 Protein ID WP_001261287.1
Coordinates 113141..113371 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS23110 (107758) 107758..109323 - 1566 WP_001128474.1 AAA family ATPase -
M9O79_RS23115 (109398) 109398..109814 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
M9O79_RS23120 (109811) 109811..110041 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M9O79_RS23125 (110428) 110428..112566 + 2139 WP_001513523.1 AAA family ATPase -
M9O79_RS23130 (112728) 112728..113144 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O79_RS23135 (113141) 113141..113371 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O79_RS23140 (113790) 113790..114479 + 690 WP_001513524.1 RES family NAD+ phosphorylase -
M9O79_RS23145 (114511) 114511..115200 - 690 WP_001513525.1 helix-turn-helix domain-containing protein -
M9O79_RS23150 (115756) 115756..115974 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
M9O79_RS23155 (115976) 115976..116281 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
M9O79_RS23160 (116282) 116282..117064 + 783 WP_001513526.1 site-specific integrase -
M9O79_RS23165 (117764) 117764..117937 + 174 Protein_114 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aph(3'')-Ib / aph(6)-Id / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..161324 161324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T246172 WP_001044768.1 NZ_CP097722:c113144-112728 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT246172 WP_001261287.1 NZ_CP097722:c113371-113141 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References