Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 112728..113371 | Replicon | plasmid pMS1665-1 |
| Accession | NZ_CP097722 | ||
| Organism | Escherichia coli strain MS1665 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | M9O79_RS23130 | Protein ID | WP_001044768.1 |
| Coordinates | 112728..113144 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | M9O79_RS23135 | Protein ID | WP_001261287.1 |
| Coordinates | 113141..113371 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O79_RS23110 (107758) | 107758..109323 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| M9O79_RS23115 (109398) | 109398..109814 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| M9O79_RS23120 (109811) | 109811..110041 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M9O79_RS23125 (110428) | 110428..112566 | + | 2139 | WP_001513523.1 | AAA family ATPase | - |
| M9O79_RS23130 (112728) | 112728..113144 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O79_RS23135 (113141) | 113141..113371 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M9O79_RS23140 (113790) | 113790..114479 | + | 690 | WP_001513524.1 | RES family NAD+ phosphorylase | - |
| M9O79_RS23145 (114511) | 114511..115200 | - | 690 | WP_001513525.1 | helix-turn-helix domain-containing protein | - |
| M9O79_RS23150 (115756) | 115756..115974 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| M9O79_RS23155 (115976) | 115976..116281 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| M9O79_RS23160 (116282) | 116282..117064 | + | 783 | WP_001513526.1 | site-specific integrase | - |
| M9O79_RS23165 (117764) | 117764..117937 | + | 174 | Protein_114 | RepB family plasmid replication initiator protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(B) / aph(3'')-Ib / aph(6)-Id / sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..161324 | 161324 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T246172 WP_001044768.1 NZ_CP097722:c113144-112728 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |