Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 109398..110041 Replicon plasmid pMS1665-1
Accession NZ_CP097722
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag M9O79_RS23115 Protein ID WP_001034044.1
Coordinates 109398..109814 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag M9O79_RS23120 Protein ID WP_001261286.1
Coordinates 109811..110041 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS23100 (105801) 105801..106497 + 697 Protein_101 IS1-like element IS1A family transposase -
M9O79_RS23105 (106751) 106751..107773 - 1023 WP_000361402.1 helicase UvrD -
M9O79_RS23110 (107758) 107758..109323 - 1566 WP_001128474.1 AAA family ATPase -
M9O79_RS23115 (109398) 109398..109814 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O79_RS23120 (109811) 109811..110041 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O79_RS23125 (110428) 110428..112566 + 2139 WP_001513523.1 AAA family ATPase -
M9O79_RS23130 (112728) 112728..113144 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
M9O79_RS23135 (113141) 113141..113371 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
M9O79_RS23140 (113790) 113790..114479 + 690 WP_001513524.1 RES family NAD+ phosphorylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aph(3'')-Ib / aph(6)-Id / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..161324 161324
- flank IS/Tn - - 105985..106497 512


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T246171 WP_001034044.1 NZ_CP097722:c109814-109398 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT246171 WP_001261286.1 NZ_CP097722:c110041-109811 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References