Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 33586..34133 Replicon plasmid pMS1665-1
Accession NZ_CP097722
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag M9O79_RS22760 Protein ID WP_001384452.1
Coordinates 33855..34133 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag M9O79_RS22755 Protein ID WP_000079941.1
Coordinates 33586..33855 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS22725 (29292) 29292..30095 + 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
M9O79_RS22730 (30095) 30095..30931 + 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
M9O79_RS22735 (31253) 31253..31507 + 255 WP_000083830.1 replication regulatory protein RepA -
M9O79_RS22740 (31546) 31546..31782 - 237 WP_223228793.1 replication protein RepA -
M9O79_RS22745 (31773) 31773..31820 + 48 WP_077822033.1 hypothetical protein -
M9O79_RS22750 (31813) 31813..32670 + 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
M9O79_RS22755 (33586) 33586..33855 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
M9O79_RS22760 (33855) 33855..34133 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
M9O79_RS22765 (34179) 34179..35027 + 849 WP_001057989.1 3'-5' exonuclease -
M9O79_RS22770 (35213) 35213..37093 + 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
M9O79_RS22775 (37115) 37115..37450 - 336 WP_001080729.1 colicin 1A immunity protein -
M9O79_RS22780 (37697) 37697..38101 + 405 WP_000839181.1 transposase -
M9O79_RS22785 (38098) 38098..38445 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / aph(3'')-Ib / aph(6)-Id / sitABCD iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..161324 161324


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T246170 WP_001384452.1 NZ_CP097722:33855-34133 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT246170 WP_000079941.1 NZ_CP097722:33586-33855 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References