Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4044503..4045301 Replicon chromosome
Accession NZ_CP097721
Organism Escherichia coli strain MS1665

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag M9O79_RS19370 Protein ID WP_000854919.1
Coordinates 4044503..4044880 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag M9O79_RS19375 Protein ID WP_001285608.1
Coordinates 4044927..4045301 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O79_RS19330 (4039533) 4039533..4040306 + 774 WP_000157137.1 type IV toxin-antitoxin system AbiEi family antitoxin -
M9O79_RS19335 (4040299) 4040299..4041216 + 918 WP_000361918.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M9O79_RS19340 (4041510) 4041510..4041677 + 168 WP_001356018.1 hypothetical protein -
M9O79_RS19345 (4041730) 4041730..4042392 - 663 WP_000357928.1 hypothetical protein -
M9O79_RS19350 (4042465) 4042465..4043106 - 642 Protein_3782 integrase arm-type DNA-binding domain-containing protein -
M9O79_RS19355 (4043573) 4043573..4043716 - 144 Protein_3783 hypothetical protein -
M9O79_RS19360 (4043801) 4043801..4043998 - 198 WP_001403937.1 DUF957 domain-containing protein -
M9O79_RS19365 (4044018) 4044018..4044506 - 489 WP_000777665.1 DUF5983 family protein -
M9O79_RS19370 (4044503) 4044503..4044880 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
M9O79_RS19375 (4044927) 4044927..4045301 - 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O79_RS19380 (4045381) 4045381..4045602 - 222 WP_000692350.1 DUF987 domain-containing protein -
M9O79_RS19385 (4045689) 4045689..4046165 - 477 WP_001186188.1 RadC family protein -
M9O79_RS19390 (4046180) 4046180..4046659 - 480 WP_000706980.1 antirestriction protein -
M9O79_RS19395 (4046739) 4046739..4047916 + 1178 WP_085968792.1 IS3 family transposase -
M9O79_RS19400 (4048187) 4048187..4048360 - 174 WP_001499034.1 hypothetical protein -
M9O79_RS19405 (4048540) 4048540..4049271 + 732 WP_001075462.1 inovirus Gp2 family protein -
M9O79_RS19410 (4049781) 4049781..4050233 + 453 WP_001100706.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4039533..4053451 13918


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T246166 WP_000854919.1 NZ_CP097721:c4044880-4044503 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT246166 WP_001285608.1 NZ_CP097721:c4045301-4044927 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References