Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4044503..4045301 | Replicon | chromosome |
| Accession | NZ_CP097721 | ||
| Organism | Escherichia coli strain MS1665 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | M9O79_RS19370 | Protein ID | WP_000854919.1 |
| Coordinates | 4044503..4044880 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2G4AEZ5 |
| Locus tag | M9O79_RS19375 | Protein ID | WP_001285608.1 |
| Coordinates | 4044927..4045301 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O79_RS19330 (4039533) | 4039533..4040306 | + | 774 | WP_000157137.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| M9O79_RS19335 (4040299) | 4040299..4041216 | + | 918 | WP_000361918.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M9O79_RS19340 (4041510) | 4041510..4041677 | + | 168 | WP_001356018.1 | hypothetical protein | - |
| M9O79_RS19345 (4041730) | 4041730..4042392 | - | 663 | WP_000357928.1 | hypothetical protein | - |
| M9O79_RS19350 (4042465) | 4042465..4043106 | - | 642 | Protein_3782 | integrase arm-type DNA-binding domain-containing protein | - |
| M9O79_RS19355 (4043573) | 4043573..4043716 | - | 144 | Protein_3783 | hypothetical protein | - |
| M9O79_RS19360 (4043801) | 4043801..4043998 | - | 198 | WP_001403937.1 | DUF957 domain-containing protein | - |
| M9O79_RS19365 (4044018) | 4044018..4044506 | - | 489 | WP_000777665.1 | DUF5983 family protein | - |
| M9O79_RS19370 (4044503) | 4044503..4044880 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| M9O79_RS19375 (4044927) | 4044927..4045301 | - | 375 | WP_001285608.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| M9O79_RS19380 (4045381) | 4045381..4045602 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| M9O79_RS19385 (4045689) | 4045689..4046165 | - | 477 | WP_001186188.1 | RadC family protein | - |
| M9O79_RS19390 (4046180) | 4046180..4046659 | - | 480 | WP_000706980.1 | antirestriction protein | - |
| M9O79_RS19395 (4046739) | 4046739..4047916 | + | 1178 | WP_085968792.1 | IS3 family transposase | - |
| M9O79_RS19400 (4048187) | 4048187..4048360 | - | 174 | WP_001499034.1 | hypothetical protein | - |
| M9O79_RS19405 (4048540) | 4048540..4049271 | + | 732 | WP_001075462.1 | inovirus Gp2 family protein | - |
| M9O79_RS19410 (4049781) | 4049781..4050233 | + | 453 | WP_001100706.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4039533..4053451 | 13918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T246166 WP_000854919.1 NZ_CP097721:c4044880-4044503 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13610.37 Da Isoelectric Point: 5.5051
>AT246166 WP_001285608.1 NZ_CP097721:c4045301-4044927 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1M0U2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4AEZ5 |