Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3448466..3449303 | Replicon | chromosome |
Accession | NZ_CP097721 | ||
Organism | Escherichia coli strain MS1665 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | M9O79_RS16625 | Protein ID | WP_000227784.1 |
Coordinates | 3448761..3449303 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | M9O79_RS16620 | Protein ID | WP_001297137.1 |
Coordinates | 3448466..3448777 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O79_RS16595 (3443486) | 3443486..3444433 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
M9O79_RS16600 (3444455) | 3444455..3446446 | + | 1992 | WP_267320579.1 | cytochrome o ubiquinol oxidase subunit I | - |
M9O79_RS16605 (3446436) | 3446436..3447050 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M9O79_RS16610 (3447050) | 3447050..3447379 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M9O79_RS16615 (3447391) | 3447391..3448281 | + | 891 | WP_000971336.1 | heme o synthase | - |
M9O79_RS16620 (3448466) | 3448466..3448777 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
M9O79_RS16625 (3448761) | 3448761..3449303 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
M9O79_RS16630 (3449359) | 3449359..3450294 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
M9O79_RS16635 (3450702) | 3450702..3452066 | + | 1365 | WP_001000978.1 | MFS transporter | - |
M9O79_RS16640 (3452194) | 3452194..3452685 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
M9O79_RS16645 (3452853) | 3452853..3453764 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T246163 WP_000227784.1 NZ_CP097721:3448761-3449303 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|