Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3414387..3415005 | Replicon | chromosome |
| Accession | NZ_CP097721 | ||
| Organism | Escherichia coli strain MS1665 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M9O79_RS16455 | Protein ID | WP_001291435.1 |
| Coordinates | 3414787..3415005 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M9O79_RS16450 | Protein ID | WP_000344800.1 |
| Coordinates | 3414387..3414761 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O79_RS16440 (3409476) | 3409476..3410669 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M9O79_RS16445 (3410692) | 3410692..3413841 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| M9O79_RS16450 (3414387) | 3414387..3414761 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M9O79_RS16455 (3414787) | 3414787..3415005 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M9O79_RS16460 (3415177) | 3415177..3415728 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| M9O79_RS16465 (3415844) | 3415844..3416314 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| M9O79_RS16470 (3416478) | 3416478..3418028 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M9O79_RS16475 (3418070) | 3418070..3418423 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
| M9O79_RS16485 (3418802) | 3418802..3419113 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| M9O79_RS16490 (3419144) | 3419144..3419716 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246162 WP_001291435.1 NZ_CP097721:3414787-3415005 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT246162 WP_000344800.1 NZ_CP097721:3414387-3414761 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |