Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2440383..2441021 | Replicon | chromosome |
Accession | NZ_CP097721 | ||
Organism | Escherichia coli strain MS1665 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | M9O79_RS11860 | Protein ID | WP_000813794.1 |
Coordinates | 2440845..2441021 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M9O79_RS11855 | Protein ID | WP_001270286.1 |
Coordinates | 2440383..2440799 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O79_RS11835 (2435535) | 2435535..2436476 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
M9O79_RS11840 (2436477) | 2436477..2437490 | - | 1014 | WP_000220416.1 | ABC transporter ATP-binding protein | - |
M9O79_RS11845 (2437508) | 2437508..2438653 | - | 1146 | WP_000047455.1 | ABC transporter substrate-binding protein | - |
M9O79_RS11850 (2438898) | 2438898..2440304 | - | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
M9O79_RS11855 (2440383) | 2440383..2440799 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
M9O79_RS11860 (2440845) | 2440845..2441021 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
M9O79_RS11865 (2441243) | 2441243..2441473 | + | 231 | WP_000494244.1 | YncJ family protein | - |
M9O79_RS11870 (2441565) | 2441565..2443526 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
M9O79_RS11875 (2443599) | 2443599..2444135 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
M9O79_RS11880 (2444227) | 2444227..2445402 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2445442..2446707 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246161 WP_000813794.1 NZ_CP097721:c2441021-2440845 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246161 WP_001270286.1 NZ_CP097721:c2440799-2440383 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|