Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1360955..1361580 | Replicon | chromosome |
| Accession | NZ_CP097721 | ||
| Organism | Escherichia coli strain MS1665 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | M9O79_RS06635 | Protein ID | WP_000911329.1 |
| Coordinates | 1361182..1361580 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | M9O79_RS06630 | Protein ID | WP_000450524.1 |
| Coordinates | 1360955..1361182 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O79_RS06605 (1356756) | 1356756..1357226 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| M9O79_RS06610 (1357226) | 1357226..1357798 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| M9O79_RS06615 (1357944) | 1357944..1358822 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| M9O79_RS06620 (1358839) | 1358839..1359873 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| M9O79_RS06625 (1360086) | 1360086..1360799 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| M9O79_RS06630 (1360955) | 1360955..1361182 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| M9O79_RS06635 (1361182) | 1361182..1361580 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O79_RS06640 (1361727) | 1361727..1362590 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| M9O79_RS06645 (1362605) | 1362605..1364620 | + | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| M9O79_RS06650 (1364694) | 1364694..1365392 | + | 699 | WP_000679812.1 | esterase | - |
| M9O79_RS06655 (1365502) | 1365502..1365702 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T246153 WP_000911329.1 NZ_CP097721:1361182-1361580 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |