Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 871068..871722 | Replicon | chromosome |
Accession | NZ_CP097721 | ||
Organism | Escherichia coli strain MS1665 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | M9O79_RS04250 | Protein ID | WP_000244772.1 |
Coordinates | 871315..871722 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M9O79_RS04245 | Protein ID | WP_000354046.1 |
Coordinates | 871068..871334 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O79_RS04220 (866356) | 866356..867099 | + | 744 | WP_000951940.1 | SDR family oxidoreductase | - |
M9O79_RS04225 (867156) | 867156..868589 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
M9O79_RS04230 (868634) | 868634..868945 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
M9O79_RS04235 (869109) | 869109..869768 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9O79_RS04240 (869845) | 869845..870825 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
M9O79_RS04245 (871068) | 871068..871334 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M9O79_RS04250 (871315) | 871315..871722 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
M9O79_RS04255 (871762) | 871762..872283 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M9O79_RS04260 (872395) | 872395..873291 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M9O79_RS04265 (873316) | 873316..874026 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9O79_RS04270 (874032) | 874032..875765 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T246151 WP_000244772.1 NZ_CP097721:871315-871722 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |