Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 121839..122374 Replicon plasmid pMS1679-1
Accession NZ_CP097720
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag M9O74_RS26030 Protein ID WP_000222760.1
Coordinates 122087..122374 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag M9O74_RS26025 Protein ID WP_001132900.1
Coordinates 121839..122090 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS25980 (116912) 116912..117259 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
M9O74_RS25985 (117259) 117259..117936 - 678 WP_001682408.1 IS66-like element accessory protein TnpA -
M9O74_RS25990 (118120) 118120..118194 + 75 Protein_121 endonuclease -
- (118450) 118450..118511 - 62 NuclAT_1 - -
- (118450) 118450..118511 - 62 NuclAT_1 - -
- (118450) 118450..118511 - 62 NuclAT_1 - -
- (118450) 118450..118511 - 62 NuclAT_1 - -
M9O74_RS25995 (118555) 118555..118704 + 150 WP_001312851.1 Hok/Gef family protein -
M9O74_RS26000 (118988) 118988..119245 + 258 WP_000083845.1 replication regulatory protein RepA -
M9O74_RS26005 (119262) 119262..119513 - 252 WP_223195197.1 replication protein RepA -
M9O74_RS26010 (119504) 119504..119551 + 48 WP_229471593.1 hypothetical protein -
M9O74_RS26015 (119544) 119544..120026 + 483 WP_001273588.1 hypothetical protein -
M9O74_RS26020 (120019) 120019..120876 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
M9O74_RS26025 (121839) 121839..122090 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9O74_RS26030 (122087) 122087..122374 + 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M9O74_RS26035 (122478) 122478..122798 + 321 Protein_130 serine acetyltransferase -
M9O74_RS26040 (122814) 122814..123197 - 384 WP_256343883.1 IS1 family transposase -
M9O74_RS26045 (123250) 123250..124272 + 1023 WP_000255956.1 IS21-like element IS100 family transposase -
M9O74_RS26050 (124269) 124269..125051 + 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
M9O74_RS26055 (125106) 125106..125470 - 365 Protein_134 IS1 family transposase -
M9O74_RS26060 (125570) 125570..126791 + 1222 Protein_135 ISL3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..201944 201944


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T246149 WP_000222760.1 NZ_CP097720:122087-122374 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT246149 WP_001132900.1 NZ_CP097720:121839-122090 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References