Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 106494..107119 | Replicon | plasmid pMS1679-1 |
Accession | NZ_CP097720 | ||
Organism | Escherichia coli strain MS1679 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M9O74_RS25940 | Protein ID | WP_000911333.1 |
Coordinates | 106494..106892 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | M9O74_RS25945 | Protein ID | WP_000450520.1 |
Coordinates | 106892..107119 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O74_RS25920 (101746) | 101746..103318 | - | 1573 | Protein_107 | IS66-like element ISCro1 family transposase | - |
M9O74_RS25925 (103338) | 103338..103685 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
M9O74_RS25930 (103685) | 103685..104362 | - | 678 | WP_001682408.1 | IS66-like element accessory protein TnpA | - |
M9O74_RS25935 (104416) | 104416..106485 | + | 2070 | Protein_110 | type IV conjugative transfer system coupling protein TraD | - |
M9O74_RS25940 (106494) | 106494..106892 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
M9O74_RS25945 (106892) | 106892..107119 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB | 1..201944 | 201944 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T246148 WP_000911333.1 NZ_CP097720:c106892-106494 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|