Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 51187..51830 Replicon plasmid pMS1679-1
Accession NZ_CP097720
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag M9O74_RS25595 Protein ID WP_001034046.1
Coordinates 51187..51603 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag M9O74_RS25600 Protein ID WP_001261278.1
Coordinates 51600..51830 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS25580 (46324) 46324..46740 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
M9O74_RS25585 (46737) 46737..46967 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
M9O74_RS25590 (47348) 47348..51142 + 3795 WP_001144732.1 hypothetical protein -
M9O74_RS25595 (51187) 51187..51603 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
M9O74_RS25600 (51600) 51600..51830 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M9O74_RS25605 (52095) 52095..52595 + 501 WP_000528932.1 HEPN family nuclease -
M9O74_RS25610 (52608) 52608..53381 + 774 WP_000905949.1 hypothetical protein -
M9O74_RS25615 (53548) 53548..54681 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
M9O74_RS25620 (54715) 54715..55203 - 489 WP_011254646.1 hypothetical protein -
M9O74_RS25625 (55771) 55771..55989 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
M9O74_RS25630 (55991) 55991..56296 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..201944 201944


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T246143 WP_001034046.1 NZ_CP097720:c51603-51187 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT246143 WP_001261278.1 NZ_CP097720:c51830-51600 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References