Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4595119..4595954 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M9O74_RS22545 | Protein ID | WP_267323347.1 |
| Coordinates | 4595577..4595954 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | F4TIK7 |
| Locus tag | M9O74_RS22540 | Protein ID | WP_001285605.1 |
| Coordinates | 4595119..4595487 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS22500 | 4590667..4591551 | + | 885 | WP_186212692.1 | 50S ribosome-binding GTPase | - |
| M9O74_RS22505 | 4591670..4592347 | + | 678 | WP_001097368.1 | hypothetical protein | - |
| M9O74_RS22510 | 4592353..4592586 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| M9O74_RS22515 | 4592676..4593494 | + | 819 | WP_001175153.1 | DUF932 domain-containing protein | - |
| M9O74_RS22520 | 4593520..4593660 | - | 141 | WP_000997937.1 | hypothetical protein | - |
| M9O74_RS22525 | 4593760..4594239 | + | 480 | WP_001696591.1 | antirestriction protein | - |
| M9O74_RS22530 | 4594255..4594731 | + | 477 | WP_001696592.1 | RadC family protein | - |
| M9O74_RS22535 | 4594818..4595039 | + | 222 | Protein_4418 | DUF987 domain-containing protein | - |
| M9O74_RS22540 | 4595119..4595487 | + | 369 | WP_001285605.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M9O74_RS22545 | 4595577..4595954 | + | 378 | WP_267323347.1 | TA system toxin CbtA family protein | Toxin |
| M9O74_RS22550 | 4595951..4596100 | + | 150 | Protein_4421 | DUF5983 family protein | - |
| M9O74_RS22555 | 4596176..4596373 | + | 198 | WP_086795284.1 | DUF957 domain-containing protein | - |
| M9O74_RS22560 | 4596458..4597300 | + | 843 | WP_001290171.1 | DUF4942 domain-containing protein | - |
| M9O74_RS22565 | 4598049..4599587 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13981.99 Da Isoelectric Point: 7.7551
>T246138 WP_267323347.1 NZ_CP097719:4595577-4595954 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHHGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHHGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.48 Da Isoelectric Point: 6.0601
>AT246138 WP_001285605.1 NZ_CP097719:4595119-4595487 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRACIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRACIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|