Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3315122..3315827 | Replicon | chromosome |
Accession | NZ_CP097719 | ||
Organism | Escherichia coli strain MS1679 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M9O74_RS16295 | Protein ID | WP_000539521.1 |
Coordinates | 3315122..3315508 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M9O74_RS16300 | Protein ID | WP_001280945.1 |
Coordinates | 3315498..3315827 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O74_RS16275 (3311126) | 3311126..3311752 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M9O74_RS16280 (3311749) | 3311749..3312864 | - | 1116 | WP_000555041.1 | aldose sugar dehydrogenase YliI | - |
M9O74_RS16285 (3312975) | 3312975..3313358 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M9O74_RS16290 (3313571) | 3313571..3314896 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M9O74_RS16295 (3315122) | 3315122..3315508 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9O74_RS16300 (3315498) | 3315498..3315827 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M9O74_RS16305 (3315897) | 3315897..3317225 | - | 1329 | WP_000086919.1 | GGDEF domain-containing protein | - |
M9O74_RS16310 (3317233) | 3317233..3319581 | - | 2349 | Protein_3202 | EAL domain-containing protein | - |
M9O74_RS16315 (3319759) | 3319759..3320670 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T246134 WP_000539521.1 NZ_CP097719:3315122-3315508 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|