Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3067761..3068545 | Replicon | chromosome |
Accession | NZ_CP097719 | ||
Organism | Escherichia coli strain MS1679 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M9O74_RS15110 | Protein ID | WP_000613624.1 |
Coordinates | 3068051..3068545 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | M9O74_RS15105 | Protein ID | WP_001110446.1 |
Coordinates | 3067761..3068054 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O74_RS15095 (3062910) | 3062910..3063869 | - | 960 | WP_000846329.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
M9O74_RS15100 (3064442) | 3064442..3067627 | + | 3186 | WP_000827395.1 | ribonuclease E | - |
M9O74_RS15105 (3067761) | 3067761..3068054 | + | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
M9O74_RS15110 (3068051) | 3068051..3068545 | + | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
M9O74_RS15115 (3068640) | 3068640..3069593 | - | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
M9O74_RS15120 (3069605) | 3069605..3071248 | - | 1644 | WP_260838220.1 | flagellar hook-associated protein FlgK | - |
M9O74_RS15125 (3071314) | 3071314..3072255 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
M9O74_RS15130 (3072255) | 3072255..3073352 | - | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T246133 WP_000613624.1 NZ_CP097719:3068051-3068545 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|