Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2653244..2653880 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
| Locus tag | M9O74_RS12925 | Protein ID | WP_000813796.1 |
| Coordinates | 2653704..2653880 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M9O74_RS12920 | Protein ID | WP_076838470.1 |
| Coordinates | 2653244..2653660 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS12900 (2648396) | 2648396..2649337 | - | 942 | WP_001251307.1 | ABC transporter permease | - |
| M9O74_RS12905 (2649338) | 2649338..2650351 | - | 1014 | WP_000220433.1 | ABC transporter ATP-binding protein | - |
| M9O74_RS12910 (2650369) | 2650369..2651514 | - | 1146 | WP_000047448.1 | ABC transporter substrate-binding protein | - |
| M9O74_RS12915 (2651759) | 2651759..2653165 | - | 1407 | WP_000760605.1 | PLP-dependent aminotransferase family protein | - |
| M9O74_RS12920 (2653244) | 2653244..2653660 | - | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M9O74_RS12925 (2653704) | 2653704..2653880 | - | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M9O74_RS12930 (2654102) | 2654102..2654332 | + | 231 | WP_000494243.1 | YncJ family protein | - |
| M9O74_RS12935 (2654424) | 2654424..2656385 | - | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M9O74_RS12940 (2656458) | 2656458..2656994 | - | 537 | WP_000429147.1 | DNA-binding transcriptional regulator SutR | - |
| M9O74_RS12945 (2657086) | 2657086..2658258 | + | 1173 | WP_032284782.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T246132 WP_000813796.1 NZ_CP097719:c2653880-2653704 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT246132 WP_076838470.1 NZ_CP097719:c2653660-2653244 [Escherichia coli]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|