Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2016336..2017167 Replicon chromosome
Accession NZ_CP097719
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M9O74_RS09685 Protein ID WP_000854814.1
Coordinates 2016336..2016710 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag M9O74_RS09690 Protein ID WP_001285585.1
Coordinates 2016799..2017167 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS09645 (2011732) 2011732..2012898 + 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M9O74_RS09650 (2013017) 2013017..2013490 + 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
M9O74_RS09655 (2013688) 2013688..2014746 + 1059 WP_001200891.1 FUSC family protein -
M9O74_RS09660 (2014918) 2014918..2015247 + 330 WP_000450409.1 DUF496 family protein -
M9O74_RS09665 (2015348) 2015348..2015671 - 324 WP_267323371.1 EutP/PduV family microcompartment system protein -
M9O74_RS09670 (2015650) 2015650..2015730 + 81 WP_023441679.1 hypothetical protein -
M9O74_RS09675 (2016019) 2016019..2016099 - 81 Protein_1894 hypothetical protein -
M9O74_RS09680 (2016145) 2016145..2016339 - 195 WP_000988600.1 DUF5983 family protein -
M9O74_RS09685 (2016336) 2016336..2016710 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M9O74_RS09690 (2016799) 2016799..2017167 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O74_RS09695 (2017241) 2017241..2017462 - 222 WP_000692323.1 DUF987 domain-containing protein -
M9O74_RS09700 (2017525) 2017525..2018001 - 477 WP_001186773.1 RadC family protein -
M9O74_RS09705 (2018017) 2018017..2018397 - 381 WP_096257200.1 antirestriction protein -
M9O74_RS09710 (2018479) 2018479..2019300 - 822 WP_101942925.1 DUF932 domain-containing protein -
M9O74_RS09715 (2019521) 2019521..2019931 - 411 WP_000846713.1 hypothetical protein -
M9O74_RS09720 (2019947) 2019947..2020630 - 684 WP_000775500.1 hypothetical protein -
M9O74_RS09725 (2020766) 2020766..2021836 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T246126 WP_000854814.1 NZ_CP097719:c2016710-2016336 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT246126 WP_001285585.1 NZ_CP097719:c2017167-2016799 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References