Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1518925..1519550 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | M9O74_RS07415 | Protein ID | WP_000911329.1 |
| Coordinates | 1519152..1519550 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | M9O74_RS07410 | Protein ID | WP_000450524.1 |
| Coordinates | 1518925..1519152 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS07385 (1514725) | 1514725..1515195 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| M9O74_RS07390 (1515195) | 1515195..1515767 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| M9O74_RS07395 (1515913) | 1515913..1516791 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| M9O74_RS07400 (1516808) | 1516808..1517842 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| M9O74_RS07405 (1518055) | 1518055..1518768 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| M9O74_RS07410 (1518925) | 1518925..1519152 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| M9O74_RS07415 (1519152) | 1519152..1519550 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O74_RS07420 (1519697) | 1519697..1520560 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| M9O74_RS07425 (1520575) | 1520575..1522590 | + | 2016 | WP_000829310.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| M9O74_RS07430 (1522664) | 1522664..1523362 | + | 699 | WP_025491901.1 | esterase | - |
| M9O74_RS07435 (1523443) | 1523443..1523643 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T246124 WP_000911329.1 NZ_CP097719:1519152-1519550 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |