Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1071645..1072299 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M9O74_RS05375 | Protein ID | WP_000244781.1 |
| Coordinates | 1071892..1072299 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M9O74_RS05370 | Protein ID | WP_000354046.1 |
| Coordinates | 1071645..1071911 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS05350 (1067723) | 1067723..1069156 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
| M9O74_RS05355 (1069201) | 1069201..1069512 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
| M9O74_RS05360 (1069676) | 1069676..1070335 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| M9O74_RS05365 (1070412) | 1070412..1071392 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
| M9O74_RS05370 (1071645) | 1071645..1071911 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M9O74_RS05375 (1071892) | 1071892..1072299 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M9O74_RS05380 (1072339) | 1072339..1072860 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M9O74_RS05385 (1072972) | 1072972..1073868 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M9O74_RS05390 (1073893) | 1073893..1074603 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M9O74_RS05395 (1074609) | 1074609..1076342 | + | 1734 | WP_000813191.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T246123 WP_000244781.1 NZ_CP097719:1071892-1072299 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|