Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 843958..844790 Replicon chromosome
Accession NZ_CP097719
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag M9O74_RS04140 Protein ID WP_000854753.1
Coordinates 843958..844332 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag M9O74_RS04145 Protein ID WP_001278232.1
Coordinates 844422..844790 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS04105 (839026) 839026..839631 + 606 WP_001318033.1 type II secretion system minor pseudopilin GspJ -
M9O74_RS04110 (839628) 839628..840605 + 978 WP_039025811.1 type II secretion system minor pseudopilin GspK -
M9O74_RS04115 (840602) 840602..841780 + 1179 WP_000097200.1 type II secretion system protein GspL -
M9O74_RS04120 (841782) 841782..842318 + 537 WP_000942807.1 GspM family type II secretion system protein YghD -
M9O74_RS04125 (842598) 842598..843167 - 570 WP_001290247.1 DUF4942 domain-containing protein -
M9O74_RS04130 (843264) 843264..843461 - 198 WP_000839281.1 DUF957 domain-containing protein -
M9O74_RS04135 (843473) 843473..843961 - 489 WP_000777541.1 DUF5983 family protein -
M9O74_RS04140 (843958) 843958..844332 - 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
M9O74_RS04145 (844422) 844422..844790 - 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O74_RS04150 (844953) 844953..845174 - 222 WP_000692303.1 DUF987 domain-containing protein -
M9O74_RS04155 (845237) 845237..845713 - 477 WP_001186710.1 RadC family protein -
M9O74_RS04160 (845725) 845725..846204 - 480 WP_000860065.1 antirestriction protein -
M9O74_RS04165 (846286) 846286..847104 - 819 WP_001234631.1 DUF932 domain-containing protein -
M9O74_RS04170 (847203) 847203..847436 - 234 WP_001278287.1 DUF905 family protein -
M9O74_RS04175 (847442) 847442..848119 - 678 WP_001097306.1 hypothetical protein -
M9O74_RS04180 (848267) 848267..848947 - 681 WP_001593697.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T246122 WP_000854753.1 NZ_CP097719:c844332-843958 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT246122 WP_001278232.1 NZ_CP097719:c844790-844422 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References