Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 331263..331858 Replicon chromosome
Accession NZ_CP097719
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name doc Uniprot ID D6JG31
Locus tag M9O74_RS01550 Protein ID WP_000155159.1
Coordinates 331481..331858 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag M9O74_RS01545 Protein ID WP_000557315.1
Coordinates 331263..331484 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS01520 (326339) 326339..327448 + 1110 WP_001318085.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
M9O74_RS01525 (327496) 327496..328422 + 927 WP_000003010.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M9O74_RS01530 (328419) 328419..329696 + 1278 WP_032284870.1 branched chain amino acid ABC transporter permease LivM -
M9O74_RS01535 (329693) 329693..330460 + 768 WP_000082101.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M9O74_RS01540 (330462) 330462..331175 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M9O74_RS01545 (331263) 331263..331484 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M9O74_RS01550 (331481) 331481..331858 + 378 WP_000155159.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M9O74_RS01555 (332067) 332067..333383 + 1317 WP_000803191.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M9O74_RS01560 (333559) 333559..334446 + 888 WP_000099289.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M9O74_RS01565 (334443) 334443..335288 + 846 WP_000572164.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M9O74_RS01570 (335290) 335290..336360 + 1071 WP_000907828.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 328419..337100 8681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(27-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13964.25 Da        Isoelectric Point: 6.7263

>T246120 WP_000155159.1 NZ_CP097719:331481-331858 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT246120 WP_000557315.1 NZ_CP097719:331263-331484 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D6JG31

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References