Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 331263..331858 | Replicon | chromosome |
| Accession | NZ_CP097719 | ||
| Organism | Escherichia coli strain MS1679 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | D6JG31 |
| Locus tag | M9O74_RS01550 | Protein ID | WP_000155159.1 |
| Coordinates | 331481..331858 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | D6JG32 |
| Locus tag | M9O74_RS01545 | Protein ID | WP_000557315.1 |
| Coordinates | 331263..331484 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O74_RS01520 (326339) | 326339..327448 | + | 1110 | WP_001318085.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| M9O74_RS01525 (327496) | 327496..328422 | + | 927 | WP_000003010.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M9O74_RS01530 (328419) | 328419..329696 | + | 1278 | WP_032284870.1 | branched chain amino acid ABC transporter permease LivM | - |
| M9O74_RS01535 (329693) | 329693..330460 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M9O74_RS01540 (330462) | 330462..331175 | + | 714 | WP_000416895.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M9O74_RS01545 (331263) | 331263..331484 | + | 222 | WP_000557315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M9O74_RS01550 (331481) | 331481..331858 | + | 378 | WP_000155159.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M9O74_RS01555 (332067) | 332067..333383 | + | 1317 | WP_000803191.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M9O74_RS01560 (333559) | 333559..334446 | + | 888 | WP_000099289.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M9O74_RS01565 (334443) | 334443..335288 | + | 846 | WP_000572164.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M9O74_RS01570 (335290) | 335290..336360 | + | 1071 | WP_000907828.1 | sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 328419..337100 | 8681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13964.25 Da Isoelectric Point: 6.7263
>T246120 WP_000155159.1 NZ_CP097719:331481-331858 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILAANPEFVELTVDVAAGKVSLEDIVTRLRQRGT
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|