Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 44560..45395 Replicon chromosome
Accession NZ_CP097719
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag M9O74_RS00230 Protein ID WP_000854735.1
Coordinates 44560..44937 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A7ZRI0
Locus tag M9O74_RS00235 Protein ID WP_012139188.1
Coordinates 45027..45395 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS00200 (39934) 39934..40752 + 819 WP_000779405.1 lipoprotein NlpA -
M9O74_RS00205 (40756) 40756..41679 - 924 WP_000535959.1 carboxylate/amino acid/amine transporter -
M9O74_RS00210 (41846) 41846..42343 - 498 WP_000509808.1 hypothetical protein -
M9O74_RS00215 (42939) 42939..43781 - 843 WP_033878271.1 DUF4942 domain-containing protein -
M9O74_RS00220 (43866) 43866..44063 - 198 WP_000839281.1 DUF957 domain-containing protein -
M9O74_RS00225 (44075) 44075..44563 - 489 WP_033878270.1 DUF5983 family protein -
M9O74_RS00230 (44560) 44560..44937 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
M9O74_RS00235 (45027) 45027..45395 - 369 WP_012139188.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O74_RS00240 (45475) 45475..45696 - 222 WP_000692345.1 DUF987 domain-containing protein -
M9O74_RS00245 (45759) 45759..46235 - 477 WP_001186775.1 RadC family protein -
M9O74_RS00250 (46251) 46251..46730 - 480 WP_033869257.1 antirestriction protein -
M9O74_RS00255 (46824) 46824..47069 - 246 WP_016238868.1 hypothetical protein -
M9O74_RS00260 (47069) 47069..47887 - 819 WP_016238867.1 DUF932 domain-containing protein -
M9O74_RS00265 (47986) 47986..48219 - 234 WP_001278287.1 DUF905 family protein -
M9O74_RS00270 (48225) 48225..48902 - 678 WP_001097305.1 hypothetical protein -
M9O74_RS00275 (49050) 49050..49730 - 681 WP_032082725.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T246118 WP_000854735.1 NZ_CP097719:c44937-44560 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13582.31 Da        Isoelectric Point: 6.2035

>AT246118 WP_012139188.1 NZ_CP097719:c45395-45027 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A7ZRI0

References