Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 30370..30962 Replicon plasmid pMS1718-2
Accession NZ_CP097718
Organism Escherichia coli strain MS1718

Toxin (Protein)


Gene name hicA Uniprot ID J7LNC2
Locus tag M9O77_RS25560 Protein ID WP_000520550.1
Coordinates 30370..30618 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag M9O77_RS25565 Protein ID WP_000681613.1
Coordinates 30615..30962 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O77_RS25520 (M9O77_25530) 25923..26258 + 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -
M9O77_RS25525 (M9O77_25535) 26255..26605 + 351 WP_000127482.1 addiction module antitoxin -
M9O77_RS25530 (M9O77_25540) 27245..27760 + 516 WP_001025395.1 J domain-containing protein -
M9O77_RS25535 (M9O77_25545) 27865..28407 + 543 WP_001083906.1 hypothetical protein -
M9O77_RS25540 (M9O77_25550) 28404..28655 + 252 WP_001230707.1 hypothetical protein -
M9O77_RS25545 (M9O77_25555) 28642..28869 + 228 WP_000801440.1 hypothetical protein -
M9O77_RS25550 (M9O77_25560) 29323..29622 + 300 WP_000650311.1 hypothetical protein -
M9O77_RS25555 (M9O77_25565) 29715..30065 + 351 WP_000854261.1 hypothetical protein -
M9O77_RS25560 (M9O77_25570) 30370..30618 + 249 WP_000520550.1 type II toxin-antitoxin system HicA family toxin Toxin
M9O77_RS25565 (M9O77_25575) 30615..30962 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M9O77_RS25570 (M9O77_25580) 31325..31828 + 504 WP_000781817.1 DNA distortion polypeptide 1 -
M9O77_RS25575 (M9O77_25585) 31832..33061 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
M9O77_RS25580 (M9O77_25590) 33138..33404 + 267 WP_000134734.1 hypothetical protein -
M9O77_RS25585 (M9O77_25595) 33409..33642 + 234 WP_000120384.1 EexN family lipoprotein -
M9O77_RS25590 (M9O77_25600) 34002..34622 + 621 WP_000157548.1 lytic transglycosylase domain-containing protein -
M9O77_RS25595 (M9O77_25605) 34636..34962 + 327 WP_000008645.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..34980 34980


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9437.05 Da        Isoelectric Point: 10.4800

>T246117 WP_000520550.1 NZ_CP097718:30370-30618 [Escherichia coli]
MGKTDKLQAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT246117 WP_000681613.1 NZ_CP097718:30615-30962 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6Y5WGJ7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References