Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 161876..162501 | Replicon | plasmid pMS1718-1 |
| Accession | NZ_CP097717 | ||
| Organism | Escherichia coli strain MS1718 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M9O77_RS25340 | Protein ID | WP_000911313.1 |
| Coordinates | 161876..162274 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | M9O77_RS25345 | Protein ID | WP_000450520.1 |
| Coordinates | 162274..162501 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O77_RS25325 (158201) | 158201..158698 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
| M9O77_RS25330 (158730) | 158730..159461 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| M9O77_RS25335 (159714) | 159714..161867 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
| M9O77_RS25340 (161876) | 161876..162274 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M9O77_RS25345 (162274) | 162274..162501 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qnrS1 / tet(A) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..170336 | 170336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T246115 WP_000911313.1 NZ_CP097717:c162274-161876 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|